Lineage for d4pd4g_ (4pd4 G:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959070Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1959071Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1959072Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1959102Protein automated matches [190325] (4 species)
    not a true protein
  7. 1959105Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (3 PDB entries)
  8. 1959110Domain d4pd4g_: 4pd4 G: [257480]
    Other proteins in same PDB: d4pd4a1, d4pd4a2, d4pd4b1, d4pd4b2, d4pd4c1, d4pd4c2, d4pd4d1, d4pd4d2, d4pd4e1, d4pd4e2, d4pd4f_, d4pd4h_, d4pd4i_, d4pd4j_, d4pd4k_
    automated match to d3cx5g_
    complexed with 3pe, 3ph, aoq, fes, hem, umq, uq6

Details for d4pd4g_

PDB Entry: 4pd4 (more details), 3.04 Å

PDB Description: structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 7

SCOPe Domain Sequences for d4pd4g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pd4g_ f.27.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
nievsk

SCOPe Domain Coordinates for d4pd4g_:

Click to download the PDB-style file with coordinates for d4pd4g_.
(The format of our PDB-style files is described here.)

Timeline for d4pd4g_: