SCOPe 2.08: Domain d4p3ya3: 4p3y A:298-394

Lineage for d4p3ya3 (4p3y A:298-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [257411] (1 PDB entry)

8. Domain d4p3ya3: 4p3y A:298-394 [257412]
   Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3yb1, d4p3yb2
   automated match to d1d8ta2
   complexed with gdp, gol, mg

Details for d4p3ya3

PDB Entry: 4p3y, 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya3:

Sequence; same for both SEQRES and ATOM records:

>d4p3ya3 b.44.1.0 (A:298-394) automated matches {Escherichia coli [TaxId: 469008]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

Timeline for d4p3ya3:

• d4p3ya3 first appeared in SCOPe 2.04
  
• d4p3ya3 appears in SCOPe 2.07