Class b: All beta proteins [48724] (178 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Escherichia coli [TaxId:469008] [257411] (1 PDB entry) |
Domain d4p3ya3: 4p3y A:298-394 [257412] Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3yb1, d4p3yb2 automated match to d1d8ta2 complexed with gdp, gol, mg |
PDB Entry: 4p3y (more details), 2.15 Å
SCOPe Domain Sequences for d4p3ya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3ya3 b.44.1.0 (A:298-394) automated matches {Escherichia coli [TaxId: 469008]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d4p3ya3: