Lineage for d4p3ya3 (4p3y A:298-394)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403547Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2403548Protein automated matches [254425] (18 species)
    not a true protein
  7. 2403578Species Escherichia coli [TaxId:469008] [257411] (1 PDB entry)
  8. 2403579Domain d4p3ya3: 4p3y A:298-394 [257412]
    Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3yb1, d4p3yb2
    automated match to d1d8ta2
    complexed with gdp, gol, mg

Details for d4p3ya3

PDB Entry: 4p3y (more details), 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3ya3 b.44.1.0 (A:298-394) automated matches {Escherichia coli [TaxId: 469008]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4p3ya3:

Click to download the PDB-style file with coordinates for d4p3ya3.
(The format of our PDB-style files is described here.)

Timeline for d4p3ya3: