SCOP 1.65: Domain d1g7ca1: 1g7c A:241-334

Lineage for d1g7ca1 (1g7c A:241-334)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (6 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
   eukaryotic and archaeal homologue of EF-Tu

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries)

8. Domain d1g7ca1: 1g7c A:241-334 [25706]
   Other proteins in same PDB: d1g7ca2, d1g7ca3, d1g7cb_
   complexed with 5gp

Details for d1g7ca1

PDB Entry: 1g7c, 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca1:

Sequence; same for both SEQRES and ATOM records:

>d1g7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

Timeline for d1g7ca1:

• d1g7ca1 first appeared (with stable ids) in SCOP 1.55
  
• d1g7ca1 appears in SCOP 1.63
  
• d1g7ca1 appears in SCOP 1.67
  
• d1g7ca1 appears in the current release, SCOPe 2.08