Class b: All beta proteins [48724] (126 folds) |
Fold b.44: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50464] (1 superfamily) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (3 proteins) |
Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50473] (4 PDB entries) |
Domain d1g7ca2: 1g7c A:335-443 [25746] Other proteins in same PDB: d1g7ca1, d1g7ca3, d1g7cb_ complexed with 5gp |
PDB Entry: 1g7c (more details), 2.05 Å
SCOP Domain Sequences for d1g7ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ca2 b.44.1.1 (A:335-443) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} casfnatvivlnhpgqisagyspvldchtahiacrfdellekndrrsgkkledhpkflks gdaalvkfvpskpmcveafseypplgrfavrdmrqtvavgviksvdkte
Timeline for d1g7ca2: