Lineage for d1g7ca1 (1g7c A:241-334)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14693Protein Elongation factor eEF-1alpha, domain 2 [50454] (1 species)
  7. 14694Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (2 PDB entries)
  8. 14696Domain d1g7ca1: 1g7c A:241-334 [25706]
    Other proteins in same PDB: d1g7ca2, d1g7ca3, d1g7cb_

Details for d1g7ca1

PDB Entry: 1g7c (more details), 2.05 Å

PDB Description: yeast eef1a:eef1ba in complex with gdpnp

SCOP Domain Sequences for d1g7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOP Domain Coordinates for d1g7ca1:

Click to download the PDB-style file with coordinates for d1g7ca1.
(The format of our PDB-style files is described here.)

Timeline for d1g7ca1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g7cb_