Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins) there is an alpha-helical subdomain inserted in this domain automatically mapped to Pfam PF00667 |
Protein Sulfite reductase flavoprotein [50441] (1 species) |
Species Escherichia coli [TaxId:562] [50442] (2 PDB entries) |
Domain d1ddga1: 1ddg A:226-446 [25671] Other proteins in same PDB: d1ddga2, d1ddgb2 complexed with fad, so4 |
PDB Entry: 1ddg (more details), 2.01 Å
SCOPe Domain Sequences for d1ddga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv gvvrydvegraraggassfladrveeegevrvfiehndnfr
Timeline for d1ddga1: