Lineage for d1ddga1 (1ddg A:226-446)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14671Family b.43.1.5: NADPH-cytochrome p450 reductase-like [50438] (2 proteins)
  6. 14676Protein Sulfite reductase flavoprotein [50441] (1 species)
  7. 14677Species Escherichia coli [TaxId:562] [50442] (2 PDB entries)
  8. 14678Domain d1ddga1: 1ddg A:226-446 [25671]
    Other proteins in same PDB: d1ddga2, d1ddgb2

Details for d1ddga1

PDB Entry: 1ddg (more details), 2.01 Å

PDB Description: crystal structure of sir-fp60

SCOP Domain Sequences for d1ddga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddga1 b.43.1.5 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli}
ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa
lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv
gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv
gvvrydvegraraggassfladrveeegevrvfiehndnfr

SCOP Domain Coordinates for d1ddga1:

Click to download the PDB-style file with coordinates for d1ddga1.
(The format of our PDB-style files is described here.)

Timeline for d1ddga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddga2