SCOP 1.67: Domain d1aigp1: 1aig P:36-258

Lineage for d1aigp1 (1aig P:36-258)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (2 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (38 PDB entries)

8. Domain d1aigp1: 1aig P:36-258 [25474]
   Other proteins in same PDB: d1aigh2, d1aigl_, d1aigm_, d1aign_, d1aigo_, d1aigp2
   complexed with bcl, bph, fe2, u10

Details for d1aigp1

PDB Entry: 1aig, 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state

SCOP Domain Sequences for d1aigp1:

Sequence; same for both SEQRES and ATOM records:

>d1aigp1 b.41.1.1 (P:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae

Timeline for d1aigp1:

• d1aigp1 first appeared (with stable ids) in SCOP 1.55
  
• d1aigp1 appears in SCOP 1.65
  
• d1aigp1 appears in SCOP 1.69
  
• d1aigp1 appears in the current release, SCOPe 2.08