SCOP 1.67: Domain d1aigm_: 1aig M:

Lineage for d1aigm_ (1aig M:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (38 PDB entries)

8. Domain d1aigm_: 1aig M: [43483]
   Other proteins in same PDB: d1aigh1, d1aigh2, d1aigl_, d1aign_, d1aigp1, d1aigp2

Details for d1aigm_

PDB Entry: 1aig, 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state

SCOP Domain Sequences for d1aigm_:

Sequence; same for both SEQRES and ATOM records:

>d1aigm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d1aigm_:

• d1aigm_ first appeared (with stable ids) in SCOP 1.55, called d1aigm1
  
• d1aigm_ appears in SCOP 1.65
  
• d1aigm_ appears in SCOP 1.69
  
• d1aigm_ appears in the current release, SCOPe 2.08