Lineage for d1aigp1 (1aig P:36-258)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14365Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
  4. 14366Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) (S)
  5. 14367Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 14368Protein Photosynthetic reaction centre [50348] (3 species)
  7. 14369Species Rhodobacter sphaeroides [TaxId:1063] [50350] (15 PDB entries)
  8. 14380Domain d1aigp1: 1aig P:36-258 [25474]
    Other proteins in same PDB: d1aigh2, d1aigl1, d1aigm1, d1aign1, d1aigo1, d1aigp2

Details for d1aigp1

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
PDB Compounds: (P:)

SCOP Domain Sequences for d1aigp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigp1 b.41.1.1 (P:36-258) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaamlae

SCOP Domain Coordinates for d1aigp1:

Click to download the PDB-style file with coordinates for d1aigp1.
(The format of our PDB-style files is described here.)

Timeline for d1aigp1: