Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) duplication: tandem repeat of two OB-fold domains |
Family b.40.16.0: automated matches [233467] (1 protein) not a true family |
Protein automated matches [233468] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [234954] (5 PDB entries) |
Domain d4l5qa1: 4l5q A:46-155 [253527] Other proteins in same PDB: d4l5qa3 automated match to d2oq0d2 |
PDB Entry: 4l5q (more details), 2.23 Å
SCOPe Domain Sequences for d4l5qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l5qa1 b.40.16.0 (A:46-155) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tpkkniskgavlhekpmtvmvltatepfnykegkenmfhatvateskyyrvkvfnmdlke kftenqfitiskyfnssgileinetatvseaapnqmfevpkniirsaket
Timeline for d4l5qa1: