![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.4: Myf domain [50277] (7 proteins) |
![]() | Protein EMAP II [50280] (1 species) domain of the p43 protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries) |
![]() | Domain d1e7za1: 1e7z A:148-319 [25318] Other proteins in same PDB: d1e7za2 contains C-terminal His tag protein/RNA complex; complexed with hg |
PDB Entry: 1e7z (more details), 2.05 Å
SCOPe Domain Sequences for d1e7za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7za1 b.40.4.4 (A:148-319) EMAP II {Human (Homo sapiens) [TaxId: 9606]} kpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmv illcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpk kkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh
Timeline for d1e7za1: