Lineage for d1e7za_ (1e7z A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14152Family b.40.4.4: Myf domain [50277] (2 proteins)
  6. 14159Protein EMAP II [50280] (1 species)
  7. 14160Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 14164Domain d1e7za_: 1e7z A: [25318]

Details for d1e7za_

PDB Entry: 1e7z (more details), 2.05 Å

PDB Description: crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex

SCOP Domain Sequences for d1e7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7za_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
akpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh

SCOP Domain Coordinates for d1e7za_:

Click to download the PDB-style file with coordinates for d1e7za_.
(The format of our PDB-style files is described here.)

Timeline for d1e7za_: