Lineage for d1e7za_ (1e7z A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789023Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 1789047Protein EMAP II [50280] (1 species)
    domain of the p43 protein
  7. 1789048Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 1789052Domain d1e7za_: 1e7z A: [25318]
    contains C-terminal His tag
    protein/RNA complex; complexed with hg

Details for d1e7za_

PDB Entry: 1e7z (more details), 2.05 Å

PDB Description: crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex
PDB Compounds: (A:) endothelial-monocyte activating polypeptide II

SCOPe Domain Sequences for d1e7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7za_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens) [TaxId: 9606]}
akpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrm
villcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnp
kkkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh

SCOPe Domain Coordinates for d1e7za_:

Click to download the PDB-style file with coordinates for d1e7za_.
(The format of our PDB-style files is described here.)

Timeline for d1e7za_: