Lineage for d1ts2a1 (1ts2 A:1-93)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789121Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 2789122Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 2789140Domain d1ts2a1: 1ts2 A:1-93 [25174]
    Other proteins in same PDB: d1ts2a2, d1ts2b2, d1ts2c2
    mutant

Details for d1ts2a1

PDB Entry: 1ts2 (more details), 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts2a1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOPe Domain Coordinates for d1ts2a1:

Click to download the PDB-style file with coordinates for d1ts2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ts2a1: