Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
Protein automated matches [190782] (2 species) not a true protein |
Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries) |
Domain d3zrsa2: 3zrs A:139-294 [250823] Other proteins in same PDB: d3zrsa1, d3zrsa3 automated match to d2wlka2 complexed with cl, k |
PDB Entry: 3zrs (more details), 3.05 Å
SCOPe Domain Sequences for d3zrsa2:
Sequence, based on SEQRES records: (download)
>d3zrsa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttlpdgrraldlgkfheia
>d3zrsa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh ayscdeiiwgghfvdvfttgrraldlgkfheia
Timeline for d3zrsa2: