Lineage for d3tzvh2 (3tzv H:119-246)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766296Domain d3tzvh2: 3tzv H:119-246 [250059]
    Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2
    automated match to d3q5ya2
    complexed with d12, gol, hex, lsc

Details for d3tzvh2

PDB Entry: 3tzv (more details), 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine
PDB Compounds: (H:) Invariant Natural Killer T Cell Receptor chain B

SCOPe Domain Sequences for d3tzvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzvh2 b.1.1.0 (H:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3tzvh2:

Click to download the PDB-style file with coordinates for d3tzvh2.
(The format of our PDB-style files is described here.)

Timeline for d3tzvh2: