Lineage for d3tzvc1 (3tzv C:8-183)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897194Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1897199Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)
  8. 1897210Domain d3tzvc1: 3tzv C:8-183 [250053]
    Other proteins in same PDB: d3tzva1, d3tzva2, d3tzvb1, d3tzvb2, d3tzvc2, d3tzvd_, d3tzvg1, d3tzvg2, d3tzvh1, d3tzvh2
    automated match to d3hujc1
    complexed with d12, gol, hex, lsc

Details for d3tzvc1

PDB Entry: 3tzv (more details), 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3tzvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzvc1 d.19.1.1 (C:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdilsfq
gtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3tzvc1:

Click to download the PDB-style file with coordinates for d3tzvc1.
(The format of our PDB-style files is described here.)

Timeline for d3tzvc1: