SCOPe 2.05: Domain d3tzvb2: 3tzv B:119-246

Lineage for d3tzvb2 (3tzv B:119-246)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3tzvb2: 3tzv B:119-246 [250052]
   Other proteins in same PDB: d3tzva2, d3tzvc1, d3tzvd_, d3tzvg2
   automated match to d3q5ya2
   complexed with d12, gol, hex, lsc

Details for d3tzvb2

PDB Entry: 3tzv, 3.06 Å

PDB Description: crystal structure of an inkt tcr in complex with cd1d- lysophosphatidylcholine

PDB Compounds: (B:) Invariant Natural Killer T Cell Receptor chain B

SCOPe Domain Sequences for d3tzvb2:

Sequence; same for both SEQRES and ATOM records:

>d3tzvb2 b.1.1.0 (B:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3tzvb2:

• d3tzvb2 first appeared in SCOPe 2.04
  
• d3tzvb2 appears in SCOPe 2.06
  
• d3tzvb2 appears in the current release, SCOPe 2.08