Lineage for d1fgbg_ (1fgb G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949390Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 949391Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 949496Domain d1fgbg_: 1fgb G: [25003]

Details for d1fgbg_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin
PDB Compounds: (G:) cholera toxin b subunit pentamer

SCOPe Domain Sequences for d1fgbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1fgbg_:

Click to download the PDB-style file with coordinates for d1fgbg_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbg_: