Lineage for d1fgbd_ (1fgb D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949390Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 949391Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 949493Domain d1fgbd_: 1fgb D: [25000]

Details for d1fgbd_

PDB Entry: 1fgb (more details), 2.4 Å

PDB Description: toxin
PDB Compounds: (D:) cholera toxin b subunit pentamer

SCOPe Domain Sequences for d1fgbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgbd_ b.40.2.1 (D:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1fgbd_:

Click to download the PDB-style file with coordinates for d1fgbd_.
(The format of our PDB-style files is described here.)

Timeline for d1fgbd_: