SCOP 1.75: Domain d1fgbg_: 1fgb G:

Lineage for d1fgbg_ (1fgb G:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
   Uniprot P01556 22-124

8. Domain d1fgbg_: 1fgb G: [25003]

Details for d1fgbg_

PDB Entry: 1fgb, 2.4 Å

PDB Description: toxin

PDB Compounds: (G:) cholera toxin b subunit pentamer

SCOP Domain Sequences for d1fgbg_:

Sequence; same for both SEQRES and ATOM records:

>d1fgbg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1fgbg_:

• d1fgbg_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgbg_ appears in SCOP 1.73
  
• d1fgbg_ appears in SCOPe 2.01
  
• d1fgbg_ appears in the current release, SCOPe 2.08