SCOPe 2.08: Domain d3s1me1: 3s1m E:2-143

Lineage for d3s1me1 (3s1m E:2-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein automated matches [254701] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255951] (3 PDB entries)

8. Domain d3s1me1: 3s1m E:2-143 [249265]
   Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me2, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_
   automated match to d1dzfa1
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1me1

PDB Entry: 3s1m, 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3s1me1:

Sequence; same for both SEQRES and ATOM records:

>d3s1me1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

Timeline for d3s1me1:

• d3s1me1 first appeared in SCOPe 2.04
  
• d3s1me1 appears in SCOPe 2.07