Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) |
Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
Protein automated matches [254701] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255951] (3 PDB entries) |
Domain d3s1me1: 3s1m E:2-143 [249265] Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me2, d3s1mf_, d3s1mh_, d3s1mi1, d3s1mi2, d3s1mj_, d3s1mk_, d3s1ml_ automated match to d1dzfa1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s1m (more details), 3.13 Å
SCOPe Domain Sequences for d3s1me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1me1 c.52.3.1 (E:2-143) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam klvpsippatietfneaalvvn
Timeline for d3s1me1: