Lineage for d3s1mi1 (3s1m I:2-49)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036361Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 3036440Protein automated matches [254700] (2 species)
    not a true protein
  7. 3036441Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255950] (4 PDB entries)
  8. 3036448Domain d3s1mi1: 3s1m I:2-49 [249269]
    Other proteins in same PDB: d3s1ma_, d3s1mb_, d3s1me1, d3s1me2, d3s1mf_, d3s1mh_, d3s1mj_, d3s1mk_, d3s1ml_
    automated match to d1twfi1
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s1mi1

PDB Entry: 3s1m (more details), 3.13 Å

PDB Description: rna polymerase ii initiation complex with a 5-nt rna (variant 1)
PDB Compounds: (I:) DNA-directed RNA polymerase II subunit RPB9

SCOPe Domain Sequences for d3s1mi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s1mi1 g.41.3.1 (I:2-49) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOPe Domain Coordinates for d3s1mi1:

Click to download the PDB-style file with coordinates for d3s1mi1.
(The format of our PDB-style files is described here.)

Timeline for d3s1mi1: