Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Heat-labile toxin [50205] (2 species) |
Species Escherichia coli, type IB [TaxId:562] [50206] (23 PDB entries) |
Domain d1fd7m_: 1fd7 M: [24896] complexed with ai1 |
PDB Entry: 1fd7 (more details), 1.8 Å
SCOPe Domain Sequences for d1fd7m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fd7m_ b.40.2.1 (M:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
Timeline for d1fd7m_: