SCOPe 2.05: Domain d3qnfc1: 3qnf C:47-254

Lineage for d3qnfc1 (3qnf C:47-254)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (11 PDB entries)

8. Domain d3qnfc1: 3qnf C:47-254 [248938]
   Other proteins in same PDB: d3qnfa2, d3qnfa3, d3qnfb2, d3qnfb3, d3qnfb4, d3qnfc2, d3qnfc3, d3qnfc4
   automated match to d2yd0a1
   complexed with nag, zn

Details for d3qnfc1

PDB Entry: 3qnf, 3 Å

PDB Description: crystal structure of the open state of human endoplasmic reticulum aminopeptidase 1 erap1

PDB Compounds: (C:) endoplasmic reticulum aminopeptidase 1

SCOPe Domain Sequences for d3qnfc1:

Sequence, based on SEQRES records:

>d3qnfc1 b.98.1.0 (C:47-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisrat
lrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykst
yrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvt
vaegliedhfdvtvkmstylvafiisdf

Sequence, based on observed residues (ATOM records):

>d3qnfc1 b.98.1.0 (C:47-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisrat
lrkgalseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
gliedhfdvtvkmstylvafiisdf

Timeline for d3qnfc1:

• d3qnfc1 first appeared in SCOPe 2.04
  
• d3qnfc1 appears in SCOPe 2.06
  
• d3qnfc1 appears in the current release, SCOPe 2.08