Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries) |
Domain d3qnfc3: 3qnf C:530-614 [248940] Other proteins in same PDB: d3qnfa1, d3qnfa2, d3qnfb1, d3qnfb2, d3qnfb4, d3qnfc1, d3qnfc2, d3qnfc4 automated match to d2yd0a3 complexed with nag, zn |
PDB Entry: 3qnf (more details), 3 Å
SCOPe Domain Sequences for d3qnfc3:
Sequence, based on SEQRES records: (download)
>d3qnfc3 b.1.30.0 (C:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktktdvl ilpeevewikfnvgmngyyivhyed
>d3qnfc3 b.1.30.0 (C:530-614) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplititvrgrnvhmkqehymktgylwhvpltfitsksdmvhrfllktktdvlilpeeve wikfnvgmngyyivhyed
Timeline for d3qnfc3: