Lineage for d3p4rc_ (3p4r C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253424Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2253444Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2253524Protein automated matches [254461] (3 species)
    not a true protein
  7. 2253541Species Escherichia coli [TaxId:701177] [256012] (2 PDB entries)
  8. 2253542Domain d3p4rc_: 3p4r C: [248416]
    Other proteins in same PDB: d3p4rb1, d3p4rb2, d3p4rn1, d3p4rn2
    automated match to d3p4pc_
    complexed with f3s, fad, fes, gua, sf4

Details for d3p4rc_

PDB Entry: 3p4r (more details), 3.05 Å

PDB Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate
PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d3p4rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4rc_ f.21.2.2 (C:) automated matches {Escherichia coli [TaxId: 701177]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOPe Domain Coordinates for d3p4rc_:

Click to download the PDB-style file with coordinates for d3p4rc_.
(The format of our PDB-style files is described here.)

Timeline for d3p4rc_: