PDB entry 3p4r

View 3p4r on RCSB PDB site
Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with glutarate
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2010-10-07, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.249
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fumarate reductase flavoprotein subunit
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: EC042_4630, frdA, SDY_4398
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV56 (0-576)
• Chain 'B':
  Compound: Fumarate reductase iron-sulfur subunit
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: frdB, EC042_4629
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV55 (0-242)
  Domains in SCOPe 2.06: d3p4rb1, d3p4rb2
• Chain 'C':
  Compound: Fumarate reductase subunit C
  Species: Escherichia coli O55:H7 [TaxId:701177]
  Gene: frdC, G2583_4981
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3QL74 (0-129)
  Domains in SCOPe 2.06: d3p4rc_
• Chain 'D':
  Compound: Fumarate reductase subunit D
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: frdD, EC042_4627
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV53 (0-118)
• Chain 'M':
  Compound: Fumarate reductase flavoprotein subunit
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: EC042_4630, frdA, SDY_4398
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV56 (0-576)
• Chain 'N':
  Compound: Fumarate reductase iron-sulfur subunit
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: frdB, EC042_4629
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV55 (0-242)
  Domains in SCOPe 2.06: d3p4rn1, d3p4rn2
• Chain 'O':
  Compound: Fumarate reductase subunit C
  Species: Escherichia coli O55:H7 [TaxId:701177]
  Gene: frdC, G2583_4981
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3QL74 (0-129)
  Domains in SCOPe 2.06: d3p4ro_
• Chain 'P':
  Compound: Fumarate reductase subunit D
  Species: Escherichia coli 042 [TaxId:216592]
  Gene: frdD, EC042_4627
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3GV53 (0-118)
• Heterogens: FES, F3S, SF4, FAD, GUA

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p4rB (B:)
  aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
  icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
  ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
  edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
  kpr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p4rC (C:)
  ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
  dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
  ivilfvalyw
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p4rN (N:)
  aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
  icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
  ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
  edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
  kpr
  

  
  
• Chain 'O':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p4rO (O:)
  ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
  dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
  ivilfvalyw
  

  
  
• Chain 'P':
  No sequence available.