Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
Protein automated matches [254461] (3 species) not a true protein |
Species Escherichia coli [TaxId:701177] [256012] (2 PDB entries) |
Domain d3p4rc_: 3p4r C: [248416] Other proteins in same PDB: d3p4rb1, d3p4rb2, d3p4rn1, d3p4rn2 automated match to d3p4pc_ complexed with f3s, fad, fes, gua, sf4 |
PDB Entry: 3p4r (more details), 3.05 Å
SCOPe Domain Sequences for d3p4rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4rc_ f.21.2.2 (C:) automated matches {Escherichia coli [TaxId: 701177]} ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat ivilfvalyw
Timeline for d3p4rc_: