SCOPe 2.08: Domain d3oedc1: 3oed C:0-65

Lineage for d3oedc1 (3oed C:0-65)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein automated matches [254612] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255501] (4 PDB entries)

8. Domain d3oedc1: 3oed C:0-65 [248213]
   Other proteins in same PDB: d3oeda1, d3oeda2, d3oedb1, d3oedb2
   automated match to d1ghqb1

Details for d3oedc1

PDB Entry: 3oed, 3.16 Å

PDB Description: The structure of the complex between complement receptor CR2 and its ligand complement fragment C3d

PDB Compounds: (C:) complement receptor type 2

SCOPe Domain Sequences for d3oedc1:

Sequence; same for both SEQRES and ATOM records:

>d3oedc1 g.18.1.1 (C:0-65) automated matches {Human (Homo sapiens) [TaxId: 9606]}
giscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
pkceyf

Timeline for d3oedc1:

• d3oedc1 first appeared in SCOPe 2.04
  
• d3oedc1 appears in SCOPe 2.07