SCOPe 2.08: Domain d3i1fa3: 3i1f A:321-415

Lineage for d3i1fa3 (3i1f A:321-415)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
   Uniprot Q980A5 321-415

8. Domain d3i1fa3: 3i1f A:321-415 [246642]
   Other proteins in same PDB: d3i1fa1, d3i1fa2, d3i1fb1, d3i1fb2
   automated match to d2qn6a2
   protein/RNA complex; complexed with gcp, po4

Details for d3i1fa3

PDB Entry: 3i1f, 2.5 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus in complex with Gpp(CH2)p

PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3i1fa3:

Sequence; same for both SEQRES and ATOM records:

>d3i1fa3 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Timeline for d3i1fa3:

• d3i1fa3 first appeared in SCOPe 2.04
  
• d3i1fa3 appears in SCOPe 2.07