Lineage for d3i1fa3 (3i1f A:321-415)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403437Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403438Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2403439Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2403514Protein Initiation factor eIF2 gamma subunit [74964] (3 species)
  7. 2403523Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
    Uniprot Q980A5 321-415
  8. 2403530Domain d3i1fa3: 3i1f A:321-415 [246642]
    Other proteins in same PDB: d3i1fa1, d3i1fa2, d3i1fb1, d3i1fb2
    automated match to d2qn6a2
    protein/RNA complex; complexed with gcp, po4

Details for d3i1fa3

PDB Entry: 3i1f (more details), 2.5 Å

PDB Description: Gamma-subunit of the translation initiation factor 2 from S. solfataricus in complex with Gpp(CH2)p
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d3i1fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1fa3 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d3i1fa3:

Click to download the PDB-style file with coordinates for d3i1fa3.
(The format of our PDB-style files is described here.)

Timeline for d3i1fa3: