Lineage for d3guaf1 (3gua F:1-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085384Domain d3guaf1: 3gua F:1-208 [246366]
    Other proteins in same PDB: d3guaa2, d3guab2, d3guac2, d3guad2, d3guae2, d3guaf2, d3guag2, d3guah2, d3guai2, d3guaj2
    automated match to d2c9ta_
    complexed with so4

Details for d3guaf1

PDB Entry: 3gua (more details), 3.1 Å

PDB Description: sulfates bound in the vestibule of achbp
PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3guaf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3guaf1 b.96.1.0 (F:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d3guaf1:

Click to download the PDB-style file with coordinates for d3guaf1.
(The format of our PDB-style files is described here.)

Timeline for d3guaf1: