Lineage for d3guaf_ (3gua F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811336Domain d3guaf_: 3gua F: [246366]
    automated match to d2c9ta_
    complexed with so4

Details for d3guaf_

PDB Entry: 3gua (more details), 3.1 Å

PDB Description: sulfates bound in the vestibule of achbp
PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3guaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3guaf_ b.96.1.0 (F:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
lvyyeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
skyeilsatqtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d3guaf_:

Click to download the PDB-style file with coordinates for d3guaf_.
(The format of our PDB-style files is described here.)

Timeline for d3guaf_: