Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries) |
Domain d3guag1: 3gua G:1-207 [246367] Other proteins in same PDB: d3guaa2, d3guab2, d3guac2, d3guad2, d3guae2, d3guaf2, d3guag2, d3guah2, d3guai2, d3guaj2 automated match to d2c9ta_ complexed with so4 |
PDB Entry: 3gua (more details), 3.1 Å
SCOPe Domain Sequences for d3guag1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3guag1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrer
Timeline for d3guag1: