Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries) |
Domain d3exfc1: 3exf C:1-361 [245931] Other proteins in same PDB: d3exfa2, d3exfb1, d3exfb2, d3exfc2, d3exfd1, d3exfd2, d3exfe2, d3exff1, d3exff2, d3exfg2, d3exfh1, d3exfh2 automated match to d3exia_ complexed with k, mg, tpp |
PDB Entry: 3exf (more details), 3 Å
SCOPe Domain Sequences for d3exfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exfc1 c.36.1.11 (C:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn maalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrfa aaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnl asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv s
Timeline for d3exfc1: