Class b: All beta proteins [48724] (126 folds) |
Fold b.34: SH3-like barrel [50036] (13 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (26 proteins) |
Protein IL-2 inducible T-cell (Itc) kinase [50060] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50061] (1 PDB entry) |
Domain d1awj__: 1awj - [24497] |
PDB Entry: 1awj (more details)
SCOP Domain Sequences for d1awj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awj__ b.34.2.1 (-) IL-2 inducible T-cell (Itc) kinase {Mouse (Mus musculus)} kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd knghegyapssylveks
Timeline for d1awj__: