Lineage for d1awj__ (1awj -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13183Protein IL-2 inducible T-cell (Itc) kinase [50060] (1 species)
  7. 13184Species Mouse (Mus musculus) [TaxId:10090] [50061] (1 PDB entry)
  8. 13185Domain d1awj__: 1awj - [24497]

Details for d1awj__

PDB Entry: 1awj (more details)

PDB Description: intramolecular itk-proline complex, nmr, minimized average structure

SCOP Domain Sequences for d1awj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awj__ b.34.2.1 (-) IL-2 inducible T-cell (Itc) kinase {Mouse (Mus musculus)}
kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
knghegyapssylveks

SCOP Domain Coordinates for d1awj__:

Click to download the PDB-style file with coordinates for d1awj__.
(The format of our PDB-style files is described here.)

Timeline for d1awj__: