Lineage for d1awj__ (1awj -)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.34: SH3-like barrel [50036] (12 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (24 proteins) 
Protein IL-2 inducible T-cell (Itc) kinase [50060] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50061] (1 PDB entry) 
Domain d1awj__: 1awj - [24497]
Details for d1awj__
PDB Entry: 1awj (more details)
PDB Description: intramolecular itk-proline complex, nmr, minimized average structure
SCOP Domain Sequences for d1awj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awj__ b.34.2.1 (-) IL-2 inducible T-cell (Itc) kinase {Mouse (Mus musculus)}
kkplpptpednrrsfqepeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqd
knghegyapssylveks
SCOP Domain Coordinates for d1awj__:
Click to download the PDB-style file with coordinates for d1awj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1awj__:
- d1awj__ first appeared (with stable ids) in SCOP 1.55
- d1awj__ appears in SCOP 1.61
- d1awj__ appears in SCOP 1.65
- d1awj__ appears in the current release, SCOPe 2.08, called d1awja_
View in 3D