Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.0: automated matches [227142] (1 protein) not a true family |
Protein automated matches [226844] (5 species) not a true protein |
Species Sapporo virus [TaxId:95342] [231278] (4 PDB entries) |
Domain d2wk4a_: 2wk4 A: [244150] automated match to d2uuta_ complexed with gol; mutant |
PDB Entry: 2wk4 (more details), 2.98 Å
SCOPe Domain Sequences for d2wk4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk4a_ e.8.1.0 (A:) automated matches {Sapporo virus [TaxId: 95342]} qwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtemlvn glkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgpfvq glkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagkrrl lwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlycldy skwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglpsgmp ftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasifht vlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywlkan rtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydq alatynawfiggtvpdpvg
Timeline for d2wk4a_: