Lineage for d2wk4b_ (2wk4 B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1693774Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 1693775Protein automated matches [226844] (5 species)
    not a true protein
  7. 1693815Species Sapporo virus [TaxId:95342] [231278] (4 PDB entries)
  8. 1693819Domain d2wk4b_: 2wk4 B: [244151]
    automated match to d2uuta_
    complexed with gol; mutant

Details for d2wk4b_

PDB Entry: 2wk4 (more details), 2.98 Å

PDB Description: dimeric structure of d347g d348g mutant of the sapporovirus rna dependent rna polymerase
PDB Compounds: (B:) protease-polymerase p70

SCOPe Domain Sequences for d2wk4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk4b_ e.8.1.0 (B:) automated matches {Sapporo virus [TaxId: 95342]}
defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasi
fhtvlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywl
kanrtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntn
ydqalatynawfiggtvpdpvg

SCOPe Domain Coordinates for d2wk4b_:

Click to download the PDB-style file with coordinates for d2wk4b_.
(The format of our PDB-style files is described here.)

Timeline for d2wk4b_: