Lineage for d2wk4a_ (2wk4 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018263Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 3018264Protein automated matches [226844] (11 species)
    not a true protein
  7. 3018316Species Sapporo virus [TaxId:95342] [231278] (4 PDB entries)
  8. 3018320Domain d2wk4a_: 2wk4 A: [244150]
    automated match to d2uuta_
    complexed with gol; mutant

Details for d2wk4a_

PDB Entry: 2wk4 (more details), 2.98 Å

PDB Description: dimeric structure of d347g d348g mutant of the sapporovirus rna dependent rna polymerase
PDB Compounds: (A:) protease-polymerase p70

SCOPe Domain Sequences for d2wk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk4a_ e.8.1.0 (A:) automated matches {Sapporo virus [TaxId: 95342]}
qwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtemlvn
glkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgpfvq
glkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagkrrl
lwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlycldy
skwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglpsgmp
ftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtygggcmysvcpatasifht
vlanltsyglkptaadksdaikptntpvflkrtftqtphgirallditsitrqfywlkan
rtsdpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydq
alatynawfiggtvpdpvg

SCOPe Domain Coordinates for d2wk4a_:

Click to download the PDB-style file with coordinates for d2wk4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wk4a_: