Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255567] (1 PDB entry) |
Domain d2qk4a3: 2qk4 A:330-429 [243585] Other proteins in same PDB: d2qk4a1, d2qk4a2, d2qk4a4, d2qk4b1, d2qk4b2, d2qk4b4 automated match to d1gsoa1 complexed with atp, cl, gol, so4 |
PDB Entry: 2qk4 (more details), 2.45 Å
SCOPe Domain Sequences for d2qk4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qk4a3 b.84.2.0 (A:330-429) automated matches {Human (Homo sapiens) [TaxId: 9606]} enhtaltvvmaskgypgdytkgveitgfpeaqalglevfhagtalkngkvvthggrvlav tairenlisaleeakkglaaikfegaiyrkdigfraiafl
Timeline for d2qk4a3:
View in 3D Domains from other chains: (mouse over for more information) d2qk4b1, d2qk4b2, d2qk4b3, d2qk4b4 |