Lineage for d2qk4a3 (2qk4 A:330-429)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817706Species Human (Homo sapiens) [TaxId:9606] [255567] (1 PDB entry)
  8. 2817707Domain d2qk4a3: 2qk4 A:330-429 [243585]
    Other proteins in same PDB: d2qk4a1, d2qk4a2, d2qk4a4, d2qk4b1, d2qk4b2, d2qk4b4
    automated match to d1gsoa1
    complexed with atp, cl, gol, so4

Details for d2qk4a3

PDB Entry: 2qk4 (more details), 2.45 Å

PDB Description: Human glycinamide ribonucleotide synthetase
PDB Compounds: (A:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d2qk4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qk4a3 b.84.2.0 (A:330-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enhtaltvvmaskgypgdytkgveitgfpeaqalglevfhagtalkngkvvthggrvlav
tairenlisaleeakkglaaikfegaiyrkdigfraiafl

SCOPe Domain Coordinates for d2qk4a3:

Click to download the PDB-style file with coordinates for d2qk4a3.
(The format of our PDB-style files is described here.)

Timeline for d2qk4a3: