SCOPe 2.08: Domain d2pyua1: 2pyu A:1-196

Lineage for d2pyua1 (2pyu A:1-196)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)

8. Domain d2pyua1: 2pyu A:1-196 [243506]
   Other proteins in same PDB: d2pyua2
   automated match to d2q16a_
   complexed with edo, imp

Details for d2pyua1

PDB Entry: 2pyu, 2.02 Å

PDB Description: structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp

PDB Compounds: (A:) Inosine Triphosphate Pyrophosphatase RdgB

SCOPe Domain Sequences for d2pyua1:

Sequence; same for both SEQRES and ATOM records:

>d2pyua1 c.51.4.0 (A:1-196) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakv
talpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhc
vlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksai
shrgqalkllldalrn

Timeline for d2pyua1:

• d2pyua1 first appeared in SCOPe 2.04, called d2pyua_
  
• d2pyua1 appears in SCOPe 2.07