SCOPe 2.04: Domain d2pyua_: 2pyu A:

Lineage for d2pyua_ (2pyu A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries)

8. Domain d2pyua_: 2pyu A: [243506]
   automated match to d2q16a_
   complexed with edo, imp

Details for d2pyua_

PDB Entry: 2pyu, 2.02 Å

PDB Description: structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp

PDB Compounds: (A:) Inosine Triphosphate Pyrophosphatase RdgB

SCOPe Domain Sequences for d2pyua_:

Sequence; same for both SEQRES and ATOM records:

>d2pyua_ c.51.4.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hhssglvprgshmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfie
nailkarhaakvtalpaiadasglavdvlggapgiysarysgedatdqknlqklletmkd
vpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegkt
aaeltreeksaishrgqalkllldalrn

Timeline for d2pyua_:

• d2pyua_ is new in SCOPe 2.04-stable
  
• d2pyua_ appears in SCOPe 2.05
  
• d2pyua_ appears in the current release, SCOPe 2.08, called d2pyua1