Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (9 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [231183] (4 PDB entries) |
Domain d2pyua1: 2pyu A:1-196 [243506] Other proteins in same PDB: d2pyua2 automated match to d2q16a_ complexed with edo, imp |
PDB Entry: 2pyu (more details), 2.02 Å
SCOPe Domain Sequences for d2pyua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyua1 c.51.4.0 (A:1-196) automated matches {Escherichia coli K-12 [TaxId: 83333]} mqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaakv talpaiadasglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfhc vlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksai shrgqalkllldalrn
Timeline for d2pyua1: