SCOPe 2.05: Domain d2koja_: 2koj A:

Lineage for d2koja_ (2koj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (13 PDB entries)

8. Domain d2koja_: 2koj A: [242595]
   automated match to d2opga_

Details for d2koja_

PDB Entry: 2koj

PDB Description: solution structure of mouse par-3 pdz2 (residues 450-558)

PDB Compounds: (A:) Partitioning defective 3 homolog

SCOPe Domain Sequences for d2koja_:

Sequence; same for both SEQRES and ATOM records:

>d2koja_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsvyntkkvgkrlniqlkkgteglgfsitsrdvtiggsapiyvknilprgaaiqdgrlka
gdrlievngvdlagksqeevvsllrstkmegtvsllvfrqeeafhpremna

Timeline for d2koja_:

• d2koja_ first appeared in SCOPe 2.04
  
• d2koja_ is called d2koja1 in SCOPe 2.06
  
• d2koja_ appears in the current release, SCOPe 2.08, called d2koja1