Lineage for d2opga_ (2opg A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helixSuperfamily b.36.1: PDZ domain-like [50156] (7 families) 
peptide-binding domainFamily b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Multiple PDZ domain protein [141267] (1 species) Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
Domain d2opga_: 2opg A: [166817]
automated match to d1d5ga_
complexed with na
Details for d2opga_
PDB Entry: 2opg (more details), 1.5 Å
PDB Description: the crystal structure of the 10th pdz domain of mpdz
PDB Compounds: (A:) Multiple PDZ domain proteinSCOPe Domain Sequences for d2opga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2opga_ b.36.1.1 (A:) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
smgcettieiskgrtglglsivggsdtllgaiiihevyeegaackdgrlwagdqilevng
idlrkathdeainvlrqtpqrvrltlyrdeapykstrl
SCOPe Domain Coordinates for d2opga_:
Click to download the PDB-style file with coordinates for d2opga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2opga_:
- d2opga_ first appeared in SCOPe 2.01
- d2opga_ appears in SCOPe 2.04
- d2opga_ is called d2opga1 in SCOPe 2.06
- d2opga_ appears in the current release, SCOPe 2.08, called d2opga1
View in 3D
